SHORT NEUROTOXIN ALPHA from Naja nigricollis Neurotoxin alpha ; Short Neurotoxin 1

$110.00$560.00

Name SHORT NEUROTOXIN alpha 
Molecular formula
Description It is an antagonist of the nicotinic acetylcholine receptor at the neuromuscular junction.


61-amino acid peptide with 4 disulfide bridges , from Naja nigricollis snake venom

Biological activity Its binding to acetylcholine receptor in vitro: 95-100 % (KD~ 2-7 10-11 M).

Immunological characterization:
Cross reactivity with:
1) N. nigricollis polyclonal antivenom + + +
2) Monoclonal antibodies to N. nigricollis toxin alpha + + +1m2

Clear
SKU: N/A Category:

Description

BUY SHORT NEUROTOXIN ALPHA from Naja nigricollis Neurotoxin alpha; Short Neurotoxin 1

Short Neurotoxin alpha is a 61 amino-acids peptide with 4 disulfide bridges, purified from Naja nigricollis snake venom.

We are the world exclusive source of this toxin.

Molecular formula: C281H457N89O91S8
Amino-Acid sequence:
 LECHNQQSSQPPTTKTCPGETNCYKKVWRDHRGTIIERGCGCPTVKPGIKLNCCTTDKCNN
Disulfide bridges : 3-23, 17-40, 42-53, 54-59
Primary structure: Click on the picture on the left.
Molecular weight : 6,795 Da
Purity : ≥ 95 % (HPLC); ≥ 98 % (Isoelectrofocusing) ; purification by double chromatography on ion exchange resin.


Biological Activity :

Short Neurotoxin alpha is an antagonist of the nicotinic acetylcholine receptor at the neuromuscular junction.

Its binding to acetylcholine receptor in vitro: 95-100 % (KD ~ 2-7 10-11 M).

Immunological characterization :
Cross reactivity with:
1) N. nigricollis polyclonal antivenom + + +
2) Monoclonal antibodies to N. nigricollis toxin alpha + + +

Identification :

  1. PRODUCT ID: L8101-Short Neurotoxin alpha
  2. CAS Number : 54992-19-7
  3. UNIPROT ID : P01426
  4. PUBChem CID : 85470794
  5. EC Number :
  6. InChI Key: UIKYTGTVQPHGMS-RGTMCVMWSA-N
  7. RTECS Number: XW5868100

Naja nigricollis Neurotoxin For Research Use Only. Not Intended for Diagnostic or Therapeutic Use.

 

Reviews

There are no reviews yet.

Be the first to review “SHORT NEUROTOXIN ALPHA from Naja nigricollis Neurotoxin alpha ; Short Neurotoxin 1”

Your email address will not be published. Required fields are marked *