Description
BUY SHORT NEUROTOXIN ALPHA from Naja nigricollis Neurotoxin alpha; Short Neurotoxin 1
Short Neurotoxin alpha is a 61 amino-acids peptide with 4 disulfide bridges, purified from Naja nigricollis snake venom.
We are the world exclusive source of this toxin.
Molecular formula: C281H457N89O91S8
Amino-Acid sequence: LECHNQQSSQPPTTKTCPGETNCYKKVWRDHRGTIIERGCGCPTVKPGIKLNCCTTDKCNN
Disulfide bridges : 3-23, 17-40, 42-53, 54-59
Primary structure: Click on the picture on the left.
Molecular weight : 6,795 Da
Purity : ≥ 95 % (HPLC); ≥ 98 % (Isoelectrofocusing) ; purification by double chromatography on ion exchange resin.
Biological Activity :
Short Neurotoxin alpha is an antagonist of the nicotinic acetylcholine receptor at the neuromuscular junction.
Its binding to acetylcholine receptor in vitro: 95-100 % (KD ~ 2-7 10-11 M).
Immunological characterization :
Cross reactivity with:
1) N. nigricollis polyclonal antivenom + + +
2) Monoclonal antibodies to N. nigricollis toxin alpha + + +
Reviews
There are no reviews yet.